PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.H01112.1.p
Common NameLOC105951111, MIMGU_mgv1a004878mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family Trihelix
Protein Properties Length: 507aa    MW: 57125.8 Da    PI: 6.9145
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.H01112.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix91.77.7e-2947130186
          trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                       rW+++e+laL+++r+em++++r+++lk+plW+evs+k+ e g++r++k+Ckek+en+ k++k++k+g++ r   + +++++fdqle
  Migut.H01112.1.p  47 RWPREETLALLKIRSEMDTAFRDSNLKAPLWDEVSRKLGELGYNRNAKKCKEKFENIYKYHKRTKDGRSIR--HKGKNYKFFDQLE 130
                       8*******************************************************************997..45567******97 PP

2trihelix97.79.9e-31336420186
          trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                       rW+k ev  Li ++++++ +++++  k+plWee+s+ m++ gfers+k+Ckekwen+nk+yk++k+g+kkr +++s+tcpyf+ le
  Migut.H01112.1.p 336 RWPKAEVESLILLKTDLDMQYEENGPKGPLWEEISACMKKLGFERSAKRCKEKWENINKYYKRVKDGNKKR-PQDSKTCPYFSMLE 420
                       8*********************************************************************8.99********9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500907.32940104IPR017877Myb-like domain
SMARTSM007171.4E-444106IPR001005SANT/Myb domain
CDDcd122033.79E-2446111No hitNo description
PfamPF138373.1E-1846130No hitNo description
PROSITE profilePS500906.876329393IPR017877Myb-like domain
SMARTSM007170.17333395IPR001005SANT/Myb domain
PfamPF138371.2E-20335422No hitNo description
CDDcd122031.08E-22336400No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010192Biological Processmucilage biosynthetic process
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 507 aa     Download sequence    Send to blast
MLESSVFLEN SGGGASGGSA SDAAAVEFGN EGGGGEEEGS RNSGGKRWPR EETLALLKIR  60
SEMDTAFRDS NLKAPLWDEV SRKLGELGYN RNAKKCKEKF ENIYKYHKRT KDGRSIRHKG  120
KNYKFFDQLE LLDSQFSVPS TPLSQIPSYA TEMTQIATTL LPKPVTNLFQ DFTIQSELMS  180
DSTSTSSSSG KDSQGSSKKK KKKKKRKLED YLEGLVKDIL EKQGEMQNKF LEAVEKSQND  240
RMARTEAWLS QEMATIKRER QILAQERSTA SAKDAYVLDF LKKITHQDLP ITHISEILDP  300
LFNNKPCDNN EQENAIVNVN SIGEKNSSSV QTSSSRWPKA EVESLILLKT DLDMQYEENG  360
PKGPLWEEIS ACMKKLGFER SAKRCKEKWE NINKYYKRVK DGNKKRPQDS KTCPYFSMLE  420
SIYANKSKKA RNNDNNNNTD VSGGGCNLKP EQILMQMMGQ VQQQNQEQLI RGEYDDGDSD  480
RQEQEDDDVS GCDGYQVVAA NNNNMS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1198206KKKKKKKRK
2200206KKKKKRK
3200207KKKKKRKL
4201206KKKKRK
5202207KKKRKL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00243DAPTransfer from AT1G76880Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012829956.10.0PREDICTED: trihelix transcription factor GT-2-like
SwissprotQ391173e-62TGT2_ARATH; Trihelix transcription factor GT-2
TrEMBLA0A022RSJ50.0A0A022RSJ5_ERYGU; Uncharacterized protein
STRINGSolyc11g005380.1.11e-148(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA97942328
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.11e-110Trihelix family protein